PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0235s0230.4.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family GRF
Protein Properties Length: 469aa    MW: 51059.7 Da    PI: 8.1162
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0235s0230.4.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC772e-2494138145
                     WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                             d+epgrCrRtDGKkWRCsr++++++k+CErH++rgr+rsrk++e+
  SapurV1A.0235s0230.4.p  94 DPEPGRCRRTDGKKWRCSRDAVADQKYCERHINRGRHRSRKPVES 138
                             79****************************************986 PP

2QLQ57.34.9e-202459237
                     QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                            +FT++Q+++L++Q+l+yKy+ a++PvP++L+ +++k
  SapurV1A.0235s0230.4.p 24 SFTPSQWMELEHQALIYKYITARVPVPSNLIIPLKK 59
                            8******************************99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.2E-112359IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.1872459IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088803.7E-142457IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.5494138IPR014977WRC domain
PfamPF088795.6E-2195137IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009624Biological Processresponse to nematode
GO:0048364Biological Processroot development
GO:0048366Biological Processleaf development
GO:0061062Biological Processregulation of nematode larval development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 469 aa     Download sequence    Send to blast
MLQARNVFCY VAGMHGTFTG VRGSFTPSQW MELEHQALIY KYITARVPVP SNLIIPLKKS  60
IYPYGLPGSS TGSFPHNSLG WSAFHLVYPG NNTDPEPGRC RRTDGKKWRC SRDAVADQKY  120
CERHINRGRH RSRKPVESQT GHAATGTASS NVLPMSNSTS KLVISSGGAS NGIAMTMQQQ  180
FKILQPAAAN SSADADVNRA QDARNISMMS STINQKSDES SFSVPKQDFS MEQCSQTEFG  240
FVSSDSLLNP SQKSSYNNSK PNESFLNFND KESQDQHAPR HFINDWPKDQ SNRSVICWPE  300
ELKSDWTQLS MSIPMASSDF SSSSSSPTHE KLALSPMRLS CEFDHVQMGL RVSIDHNESS  360
QKQTNWIPIS WGTSIGGPLG EVLTTNTSHA DSCKSSSALS LLREGCDGSP QLRSSPTGVL  420
QKSAFCSLSN SSSGSSPRAE SKKNNDTASL YEDVLGSIIA SSSPIPSL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818753e-44LN681875.1 Cucumis melo genomic scaffold, anchoredscaffold00007.
GenBankLN7132623e-44LN713262.1 Cucumis melo genomic chromosome, chr_8.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011007851.10.0PREDICTED: growth-regulating factor 1-like
SwissprotO810011e-109GRF1_ARATH; Growth-regulating factor 1
TrEMBLB9IBM40.0B9IBM4_POPTR; Uncharacterized protein
STRINGPOPTR_0014s00780.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22840.12e-95growth-regulating factor 1